PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn138771
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family MYB_related
Protein Properties Length: 124aa    MW: 13803.8 Da    PI: 9.5258
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn138771genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding30.39.4e-101545131
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartm 31
                     +g W++eEde+l ++++++G g+W+t+++  
       Achn138771 15 KGLWSPEEDEKLFNYITKFGVGCWSTVPKLA 45
                     678************************9976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.76E-10755IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.2E-13956IPR009057Homeodomain-like
PROSITE profilePS512949.6511062IPR017930Myb domain
PfamPF002499.6E-71545IPR001005SANT/Myb domain
CDDcd001671.72E-61843No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 124 aa     Download sequence    Send to blast
MGRQSCNLVK PKLRKGLWSP EEDEKLFNYI TKFGVGCWST VPKLAVIENR EHFVCQKIVP  60
SETIFENSYP KNKCPASVSF YSTIPNLLSP KLATYGGRKP VTAKPTFTHP STPETSQLNN  120
TDP*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA1740934
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26660.13e-19myb domain protein 86